Structure of PDB 4jr0 Chain A Binding Site BS01

Receptor Information
>4jr0 Chain A (length=226) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLK
YEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNG
PVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTKIPVEADFLYAYSTAP
GYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFS
FDATFHAKKQIPCIVSMLTKELYFYH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jr0 Structural snapshots reveal distinct mechanisms of procaspase-3 and -7 activation.
Resolution1.796 Å
Binding residue
(original residue number in PDB)		R64 H121 Q161 C163 S205 W206 R207 N208 S209 S249 F250
Binding residue
(residue number reindexed from 1)		R32 H89 Q129 C131 S154 W155 R156 N157 S158 S198 F199
Enzymatic activity
Catalytic site (original residue number in PDB) T62 S63 H121 G122 C163 R164
Catalytic site (residue number reindexed from 1) T30 S31 H89 G90 C131 R132
Enzyme Commision number 3.4.22.56: caspase-3.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4jr0, PDBe:4jr0, PDBj:4jr0
PDBsum4jr0
PubMed23650375
UniProtP42574|CASP3_HUMAN Caspase-3 (Gene Name=CASP3)

[Back to BioLiP]