Structure of PDB 4jnx Chain A Binding Site BS01

Receptor Information
>4jnx Chain A (length=124) Species: 12145 (Tomato bushy stunt virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMTSPFKLPDESPSWTEWRLHNDETNQDNPLGFKESWGFGKVVFKRYLR
YDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSG
GSRTLQHLCEMAIRSKQELLQLAP
Ligand information
>4jnx Chain B (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcugcugcugcugcugcugc
....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jnx Procrustean bed of RNA silencing suppression
Resolution1.95 Å
Binding residue
(original residue number in PDB)		W17 K45 R93 S98
Binding residue
(residue number reindexed from 1)		W16 K42 R90 S95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0044423 virion component

View graph for
Cellular Component
External links
PDB RCSB:4jnx, PDBe:4jnx, PDBj:4jnx
PDBsum4jnx
PubMed
UniProtP69517|P19_TBSVK RNA silencing suppressor p19 (Gene Name=ORF4)

[Back to BioLiP]