Structure of PDB 4jng Chain A Binding Site BS01

Receptor Information
>4jng Chain A (length=226) Species: 1133363 (Schmallenberg virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QFIFEDVPQRNAATFNPEVGYVAFIGKYGQQLNFGVARVFFLNQKKAKMV
LHKTAQPSVDLTFGGVKFTVVNNHFPQYVSNPVPDNAITLHRMSGYLARW
IADTCKASVLKLAEASAQIVMPLAEVKGCTWADGYTMYLGFAPGAEMFLD
AFDFYPLVIEMHRVLKDNMDVNFMKKVLRQRYGTMTAEEWMTQKITEIKA
AFNSVGQLAWAKSGFSPAARTFLQQF
Ligand information
>4jng Chain L (length=42) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu
..........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jng Crystal structure of Schmallenberg orthobunyavirus nucleoprotein-RNA complex reveals a novel RNA sequestration mechanism.
Resolution2.12 Å
Binding residue
(original residue number in PDB)		Q12 N14 A15 A16 F18 N19 P20 L45 K48 N76 H77 V82 V86 R95 V123 P125 L126 R166 M172 F176 K178 K179 R182 Q183 R184
Binding residue
(residue number reindexed from 1)		Q9 N11 A12 A13 F15 N16 P17 L42 K45 N73 H74 V79 V83 R92 V120 P122 L123 R163 M169 F173 K175 K176 R179 Q180 R181
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019013 viral nucleocapsid
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4jng, PDBe:4jng, PDBj:4jng
PDBsum4jng
PubMed23798666
UniProtH2AM13|NCAP_SBVBH Nucleoprotein (Gene Name=N)

[Back to BioLiP]