Structure of PDB 4jml Chain A Binding Site BS01

Receptor Information
>4jml Chain A (length=394) Species: 536056 (Escherichia coli DH1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGRPIGVVPFQWAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEV
QPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKV
NKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSD
YDGYNQFVVHRSPQCLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAV
RQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDG
RSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQD
ADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNG
TMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL
Ligand information
>4jml Chain E (length=16) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GCSDGSGWSSENNPWG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jml Intrinsically disordered protein threads through the bacterial outer-membrane porin OmpF.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Q172 Y180 C201 L202 M203 S204 F219 H245 A248 L268 N289 T291 E292 T305 D307 P312 K422 F423
Binding residue
(residue number reindexed from 1)		Q136 Y144 C165 L166 M167 S168 F183 H209 A212 L232 N253 T255 E256 T269 D271 P276 K386 F387
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 29 03:11:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4jml', asym_id = 'A', bs = 'BS01', title = 'Intrinsically disordered protein threads through the bacterial outer-membrane porin OmpF.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4jml', asym_id='A', bs='BS01', title='Intrinsically disordered protein threads through the bacterial outer-membrane porin OmpF.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0015031,0017038,0042597', uniprot = '', pdbid = '4jml', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015031,0017038,0042597', uniprot='', pdbid='4jml', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>