Structure of PDB 4jl0 Chain A Binding Site BS01

Receptor Information
>4jl0 Chain A (length=132) Species: 1227568 (Pseudomonas aeruginosa CHA) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LRGLSEDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLG
ACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGF
YSARALAAAQPAHEALAARAGAMLEAVTARKD
Ligand information
>4jl0 Chain C (length=9) Species: 1227568 (Pseudomonas aeruginosa CHA) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TGVALTPPS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jl0 Membrane and Chaperone Recognition by the Major Translocator Protein PopB of the Type III Secretion System of Pseudomonas aeruginosa.
Resolution2.22 Å
Binding residue
(original residue number in PDB)		E37 Y40 A41 F44 Y47 A78 R105 H109
Binding residue
(residue number reindexed from 1)		E10 Y13 A14 F17 Y20 A51 R78 H82
Enzymatic activity
Enzyme Commision number ?
External links