Structure of PDB 4jjn Chain A Binding Site BS01

Receptor Information
>4jjn Chain A (length=98) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS
Ligand information
>4jjn Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatccgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jjn Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
Resolution3.09 Å
Binding residue
(original residue number in PDB)		H39 Y41 P43 G44 V46 A47 R49 R63 K64 L65 P66 R69 R83
Binding residue
(residue number reindexed from 1)		H2 Y4 P6 G7 V9 A10 R12 R26 K27 L28 P29 R32 R46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008823 cupric reductase (NADH) activity
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
GO:0006878 intracellular copper ion homeostasis
GO:0009060 aerobic respiration
GO:0009303 rRNA transcription
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0043935 sexual sporulation resulting in formation of a cellular spore
GO:0045943 positive regulation of transcription by RNA polymerase I
GO:0070911 global genome nucleotide-excision repair
Cellular Component
GO:0000500 RNA polymerase I upstream activating factor complex
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4jjn, PDBe:4jjn, PDBj:4jjn
PDBsum4jjn
PubMed23650358
UniProtP61830|H3_YEAST Histone H3 (Gene Name=HHT1)

[Back to BioLiP]