Structure of PDB 4jif Chain A Binding Site BS01

Receptor Information
>4jif Chain A (length=130) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CAEFRIKYVGAIEKLKLLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGV
SKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASN
EEYSLWVYQCNSLEQAQAICKVLSTAFDSV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jif Cocrystal structure of the ICAP1 PTB domain in complex with a KRIT1 peptide.
Resolution1.701 Å
Binding residue
(original residue number in PDB)		P85 I89 D93 Q96 Y136 I138 I139 R140 M141 V142 C143 Y144 D145 D146 G147 T160 C184 F191
Binding residue
(residue number reindexed from 1)		P21 I25 D29 Q32 Y72 I74 I75 R76 M77 V78 C79 Y80 D81 D82 G83 T96 C120 F127
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4jif, PDBe:4jif, PDBj:4jif
PDBsum4jif
PubMed23695561
UniProtO14713|ITBP1_HUMAN Integrin beta-1-binding protein 1 (Gene Name=ITGB1BP1)

[Back to BioLiP]