Structure of PDB 4jhj Chain A Binding Site BS01

Receptor Information
>4jhj Chain A (length=216) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDYKIQSFDLETQKLLKTALKDPGSVDLEKVSSVIVDQSLKDQVFSREAG
RICYTIVQAEAKQTNGSVFRRNLLNRLQQEFKAREETRKRSTQEWVCLVS
FICNIFDYLKVNNMPMVALVHPVYDCLFRLAQSDALKNEEEVDCLVLQLH
RIGDQLEKMNVQLMDELFNLLRDGFLLQEDLSSMGRLLLLEILEFRAGGW
KLSDTAQKYYYSEVTD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jhj Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins.
Resolution3.25 Å
Binding residue
(original residue number in PDB)		R76 R77 Q84 F87 V117 N118 M122 V123 A124 L125 P128
Binding residue
(residue number reindexed from 1)		R70 R71 Q78 F81 V111 N112 M116 V117 A118 L119 P122
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008494 translation activator activity
GO:0042802 identical protein binding
Biological Process
GO:0002191 cap-dependent translational initiation
GO:0006417 regulation of translation
GO:0006446 regulation of translational initiation
GO:0045727 positive regulation of translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0062073 histone mRNA stem-loop binding complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4jhj, PDBe:4jhj, PDBj:4jhj
PDBsum4jhj
PubMed23804756
UniProtQ5EAQ1|M4GDB_DANRE MIF4G domain-containing protein B (Gene Name=mif4gdb)

[Back to BioLiP]