Structure of PDB 4jgn Chain A Binding Site BS01

Receptor Information
>4jgn Chain A (length=125) Species: 12145 (Tomato bushy stunt virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMTSPFKLPDESPSWTEWRLHNDETNSNQDNPLGFKESWGFGKVVFKRYL
RYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVS
GGSRTLQHLCEMAIRSKQELLQLAP
Ligand information
>4jgn Chain E (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uugcugcugcugcugcugcu
....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jgn Procrustean bed of RNA silencing suppression
Resolution1.86 Å
Binding residue
(original residue number in PDB)		S14 P15 W17 W20 N30 Q31 P34 K38 Y51 Q85 I86 G87 R93 G96 S102 G103 G104
Binding residue
(residue number reindexed from 1)		S12 P13 W15 W18 N28 Q29 P32 K36 Y49 Q83 I84 G85 R91 G94 S100 G101 G102
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0044423 virion component

View graph for
Cellular Component
External links
PDB RCSB:4jgn, PDBe:4jgn, PDBj:4jgn
PDBsum4jgn
PubMed
UniProtP69517|P19_TBSVK RNA silencing suppressor p19 (Gene Name=ORF4)

[Back to BioLiP]