Structure of PDB 4jgj Chain A Binding Site BS01

Receptor Information
>4jgj Chain A (length=105) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALLTSKEMRFSAAEGAKVLLSVPDNLLSFSWYKGKDVNENFTIAHYKKSS
DSLQLGKKVSGREEIYKDGSMMLRAITLEDTGFYTLQTFKGQQEVTHVHL
QVYKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jgj Crystal structure of the Ig-like D1 domain of CEACAM15 from Mus musculus [NYSGRC-005691]
Resolution2.6508 Å
Binding residue
(original residue number in PDB)
L30 T31 S32 K33
Binding residue
(residue number reindexed from 1)
L3 T4 S5 K6
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4jgj, PDBe:4jgj, PDBj:4jgj
PDBsum4jgj
PubMed
UniProtA0A0B4J1L0|CEA15_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 15 (Gene Name=Ceacam15)

[Back to BioLiP]