Structure of PDB 4je8 Chain A Binding Site BS01

Receptor Information
>4je8 Chain A (length=192) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLPEIVASGDPVLHEKAREVDPGEIGSERIQKIIDDMIKVMRLAPCVGLA
APQIGVPLRIIVLEDTKEYISYAPKEEILAQERRHFDLMVMVNPVLKERS
NKKALFFEGCESVDGFRAAVERYLEVVVTGYDRQGKRIEVNASGWQARIL
QHECDHLDGNLYVDKMVPRTFRTVDNLDLPLAEGCPKLGSHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4je8 Understanding the highly efficient catalysis of prokaryotic peptide deformylases by shedding light on the determinants specifying the low activity of the human counterpart.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		C47 V48 G49 E109 G110 E112 R118 W146 E154
Binding residue
(residue number reindexed from 1)		C46 V47 G48 E108 G109 E111 R117 W145 E153
Enzymatic activity
Catalytic site (original residue number in PDB) G49 Q54 C111 E112 H153 E154 H157
Catalytic site (residue number reindexed from 1) G48 Q53 C110 E111 H152 E153 H156
Enzyme Commision number 3.5.1.88: peptide deformylase.
Gene Ontology
Molecular Function
GO:0042586 peptide deformylase activity

View graph for
Molecular Function
External links
PDB RCSB:4je8, PDBe:4je8, PDBj:4je8
PDBsum4je8
PubMed24531459
UniProtQ9FV53|DEF1A_ARATH Peptide deformylase 1A, chloroplastic/mitochondrial (Gene Name=PDF1A)

[Back to BioLiP]