Structure of PDB 4jcx Chain A Binding Site BS01

Receptor Information

>4jcx Chain A (length=94) Species: 315237 (Citrobacter sp. RFL231) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MLIRRLKDARLRAGISQEKLGVLAGIDEASASARMNQYEKGKHAPDFEMA
NRLAKVLKIPVSYLYTPEDDLAQIILTWNELNEQERKRINFYIR

Ligand information

>4jcx Chain C (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acactaaggaaaacttagtaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4jcx Structural analysis of DNA binding by C.Csp231I, a member of a novel class of R-M controller proteins regulating gene expression.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	S16 Q17 N36 K40
Binding residue (residue number reindexed from 1)	S16 Q17 N36 K40

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:4jcx, PDBe:4jcx, PDBj:4jcx
PDBsum	4jcx
PubMed	25664751
UniProt	Q32WH4

[Back to BioLiP]