Structure of PDB 4jbk Chain A Binding Site BS01

Receptor Information
>4jbk Chain A (length=192) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESQYYR
VKVFNMDLKEKFTENKFITISKYFNSSGILEINETATVSEAAPNQMFEVP
KNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNED
NIKVVWDKEQHNINKLQLFSFHLRKGNGKPILHSGNHSFIKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jbk Structural basis for termination of AIM2-mediated signaling by p202
Resolution2.963 Å
Binding residue
(original residue number in PDB)		S123 H179 R181 G192 N193
Binding residue
(residue number reindexed from 1)		S121 H172 R174 G185 N186
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002218 activation of innate immune response
GO:0035458 cellular response to interferon-beta

View graph for
Biological Process
External links
PDB RCSB:4jbk, PDBe:4jbk, PDBj:4jbk
PDBsum4jbk
PubMed23567559
UniProtQ9R002|IFI2_MOUSE Interferon-activable protein 202 (Gene Name=Ifi202)

[Back to BioLiP]