Structure of PDB 4j9h Chain A Binding Site BS01

Receptor Information

>4j9h Chain A (length=59) Species: 9606 (Homo sapiens)

DPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWV
PSNYITPVN

Ligand information

>4j9h Chain G (length=10)

APTYPPPPPP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4j9h Crystallization by capillary counter-diffusion and structure determination of the N114A mutant of the SH3 domain of Abl tyrosine kinase complexed with a high-affinity peptide ligand.
• Resolution: 1.7 Å
• Binding residue (original residue number in PDB): Y70 S75 D77 E98 W99 W110 N114 Y115
• Binding residue (residue number reindexed from 1): Y9 S14 D16 E37 W38 W49 N53 Y54

Enzymatic activity

• Enzyme Commision number: 2.7.10.2: non-specific protein-tyrosine kinase.

External links

• PDB: RCSB:4j9h, PDBe:4j9h, PDBj:4j9h
• PDBsum: 4j9h
• UniProt: P00519|ABL1_HUMAN Tyrosine-protein kinase ABL1 (Gene Name=ABL1)