Structure of PDB 4j9f Chain A Binding Site BS01

Receptor Information

>4j9f Chain A (length=62) Species: 9606 (Homo sapiens)

MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQ
GWVPSNYITPVN

Ligand information

>4j9f Chain B (length=10) Species: 9606 (Homo sapiens)

APTYPPPLPP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4j9f Crystallization by capillary counter-diffusion and structure determination of the N114A mutant of the SH3 domain of Abl tyrosine kinase complexed with a high-affinity peptide ligand.
• Resolution: 1.094 Å
• Binding residue (original residue number in PDB): Y70 F72 D77 E98 W99 W110 P112 N114 Y115
• Binding residue (residue number reindexed from 1): Y12 F14 D19 E40 W41 W52 P54 N56 Y57

Enzymatic activity

• Enzyme Commision number: 2.7.10.2: non-specific protein-tyrosine kinase.

External links

• PDB: RCSB:4j9f, PDBe:4j9f, PDBj:4j9f
• PDBsum: 4j9f
• UniProt: P00519|ABL1_HUMAN Tyrosine-protein kinase ABL1 (Gene Name=ABL1)