Structure of PDB 4j8s Chain A Binding Site BS01

Receptor Information

>4j8s Chain A (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QQTDLSQVWPEANQHFSKEIDDEANSYFQRIYNHPPHPTMSVDEVLEMLQ
RFKDSTIKREREVFNCMLRNLFEEYRFFPQYPDKELHITACLFGGIIEKG
LVTYMALGLALRYVLEALRKPFGSKMYYFGIAALDRFKNRLKDYPQYCQH
LASISHFMQFPHHLQEYIEYGQQSRDPPVK

Ligand information

>4j8s Chain B (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RRLPIFNRISVS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4j8s Structural basis for the recruitment of the human CCR4-NOT deadenylase complex by tristetraprolin.
Resolution	1.55 Å
Binding residue (original residue number in PDB)	E825 N839 F842 Q843 N884 E888 F891 Q894 Y895 P896
Binding residue (residue number reindexed from 1)	E11 N25 F28 Q29 N70 E74 F77 Q80 Y81 P82

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0017148	negative regulation of translation

	Cellular Component
GO:0030015	CCR4-NOT core complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4j8s, PDBe:4j8s, PDBj:4j8s
PDBsum	4j8s
PubMed	23644599
UniProt	A5YKK6\|CNOT1_HUMAN CCR4-NOT transcription complex subunit 1 (Gene Name=CNOT1)

[Back to BioLiP]