Structure of PDB 4j7l Chain A Binding Site BS01

Receptor Information
>4j7l Chain A (length=358) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSLRTQPSLYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPIN
GPGPDFDLRDGYPDRYQPRDEEVQERLDHLLRWVLEHRNQLEGGPGWLAG
ATVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPAARAQRLA
RPPLLRELMYMGYKFEQYMCADKPGGSPDPSGEVNTNVAYCSVLRSRLGN
HPLLFSGEVDCLNPQAPCTQPPSCYVELKTSKEMHSPGQWRSFYRHKLLK
WWAQSFLPGVPHVVAGFRNPEGFVCSLKTFPTMEMFENVRNDREGWNPSV
CMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHRDAPYAFLPS
WYVETMTQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4j7l A mammalian pre-mRNA 5' end capping quality control mechanism and an unexpected link of capping to pre-mRNA processing.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
E144 R145 Q146 L181 L184 M185 G188 Y189 D236 E253 K255 T256 K258 H272 K273 K276 R294
Binding residue
(residue number reindexed from 1)
E118 R119 Q120 L155 L158 M159 G162 Y163 D210 E227 K229 T230 K232 H246 K247 K250 R268
Enzymatic activity
Enzyme Commision number 3.1.13.-
3.6.1.-
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0000287 magnesium ion binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0004527 exonuclease activity
GO:0008409 5'-3' exonuclease activity
GO:0034353 mRNA 5'-diphosphatase activity
GO:0046872 metal ion binding
GO:0110152 RNA NAD+-cap (NAD+-forming) hydrolase activity
Biological Process
GO:0006402 mRNA catabolic process
GO:0050779 RNA destabilization
GO:0071028 nuclear mRNA surveillance
GO:0090304 nucleic acid metabolic process
GO:0110155 NAD-cap decapping
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4j7l, PDBe:4j7l, PDBj:4j7l
PDBsum4j7l
PubMed23523372
UniProtO70348|DXO_MOUSE Decapping and exoribonuclease protein (Gene Name=Dxo)

[Back to BioLiP]