Structure of PDB 4j7f Chain A Binding Site BS01

Receptor Information
>4j7f Chain A (length=241) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVCWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMIE
GKLATLMSTEEGRPHFELMPGNSVYHFDKSTSSCISTNALLPDPYESERV
YVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNGNT
LSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPI
KCIRTLRAVEADEELTVAFGYDHSPPEAPEWYQVELKAFQA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4j7f Methyl CH O Hydrogen Bonds Orchestrate AdoMet-Dependent Methylation
Resolution1.59 Å
Binding residue
(original residue number in PDB)		Y245 V255 D256 R258 W260 N263 T266 L267 S268 Y305 K317 X335 Y337 E348
Binding residue
(residue number reindexed from 1)		Y129 V139 D140 R142 W144 N147 T150 L151 S152 Y189 K201 X219 Y221 E227
Enzymatic activity
Catalytic site (original residue number in PDB) Y245 H293 H297 Y305 F335
Catalytic site (residue number reindexed from 1) Y129 H177 H181 Y189 F219
Enzyme Commision number 2.1.1.364: [histone H3]-lysine(4) N-methyltransferase.
Gene Ontology
Molecular Function
GO:0016279 protein-lysine N-methyltransferase activity
GO:0140945 histone H3K4 monomethyltransferase activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4j7f, PDBe:4j7f, PDBj:4j7f
PDBsum4j7f
PubMed
UniProtQ8WTS6|SETD7_HUMAN Histone-lysine N-methyltransferase SETD7 (Gene Name=SETD7)

[Back to BioLiP]