Structure of PDB 4j5v Chain A Binding Site BS01

Receptor Information
>4j5v Chain A (length=122) Species: 12145 (Tomato bushy stunt virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTSPFKLPDESPSWTEWRLHNDETNQDNPLGFKESWGFGKVVFKRYLRYD
RTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGS
RTLQHLCEMAIRSKQELLQLAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4j5v Structural insights into CNG-repetitive RNAs associated with human Trinucleotide Repeat Expansion Diseases (TREDs)
Resolution2.15 Å
Binding residue
(original residue number in PDB)		P15 W17 W20 K38 Y51 Q85 I86 G87 S102 G104
Binding residue
(residue number reindexed from 1)		P12 W14 W17 K33 Y46 Q80 I81 G82 S97 G99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0044423 virion component

View graph for
Cellular Component
External links
PDB RCSB:4j5v, PDBe:4j5v, PDBj:4j5v
PDBsum4j5v
PubMed
UniProtP69517|P19_TBSVK RNA silencing suppressor p19 (Gene Name=ORF4)

[Back to BioLiP]