Structure of PDB 4j45 Chain A Binding Site BS01

Receptor Information
>4j45 Chain A (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQC
FACGGKLKNWEPGDRAWSEHRRHFPNCFFVLGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4j45 The structure of XIAP BIR2: understanding the selectivity of the BIR domains.
Resolution1.48 Å
Binding residue
(original residue number in PDB)
K206 L207 K208 W210 D214 E219 H223
Binding residue
(residue number reindexed from 1)
K56 L57 K58 W60 D64 E69 H73
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0043027 cysteine-type endopeptidase inhibitor activity involved in apoptotic process
Biological Process
GO:0043066 negative regulation of apoptotic process

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4j45, PDBe:4j45, PDBj:4j45
PDBsum4j45
PubMed23999295
UniProtP98170|XIAP_HUMAN E3 ubiquitin-protein ligase XIAP (Gene Name=XIAP)

[Back to BioLiP]