Structure of PDB 4j2j Chain A Binding Site BS01

Receptor Information
>4j2j Chain A (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTLPPYFMKGSMIQLANGELKKVEDLKTEDFIQSAEMSNDLKIDSSTVER
IEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQ
LFDLPCSKLSVGDVCISLTLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4j2j Structural basis of protein complex formation and reconfiguration by polyglutamine disease protein Ataxin-1 and Capicua
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y574 M580 I581 Q582 S602 L609 S614 I684 S685 L686
Binding residue
(residue number reindexed from 1)		Y6 M12 I13 Q14 S34 L41 S46 I116 S117 L118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4j2j, PDBe:4j2j, PDBj:4j2j
PDBsum4j2j
PubMed23512657
UniProtP54253|ATX1_HUMAN Ataxin-1 (Gene Name=ATXN1)

[Back to BioLiP]