Structure of PDB 4j1v Chain A Binding Site BS01

Receptor Information
>4j1v Chain A (length=166) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAG
PRYEYHWADPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMS
VAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLI
DRRELAPLQELIEKLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4j1v Seed Sequence-Matched Controls Reveal Limitations of Small Interfering RNA Knockdown in Functional and Structural Studies of Hepatitis C Virus NS5A-MOBKL1B Interaction.
Resolution1.95 Å
Binding residue
(original residue number in PDB)
P91 R92 Y93 E94 Y95 H96 D99 Y114 R154 R157 R199
Binding residue
(residue number reindexed from 1)
P51 R52 Y53 E54 Y55 H56 D59 Y68 R108 R111 R153
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4j1v, PDBe:4j1v, PDBj:4j1v
PDBsum4j1v
PubMed25031347
UniProtQ9H8S9|MOB1A_HUMAN MOB kinase activator 1A (Gene Name=MOB1A)

[Back to BioLiP]