Structure of PDB 4j19 Chain A Binding Site BS01

Receptor Information
>4j19 Chain A (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSRFTWRKECLAVMESYFNENQYPDEAKREEIANACNAVIQKPGKKLSDL
ERVTSLKVYNWFANRRKEIKRRANIEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4j19 HOT1 is a mammalian direct telomere repeat-binding protein contributing to telomerase recruitment.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R271 Y291 R334 K335 K338
Binding residue
(residue number reindexed from 1)		R3 Y23 R66 K67 K70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003691 double-stranded telomeric DNA binding

View graph for
Molecular Function
External links
PDB RCSB:4j19, PDBe:4j19, PDBj:4j19
PDBsum4j19
PubMed23685356
UniProtQ6NT76|HMBX1_HUMAN Homeobox-containing protein 1 (Gene Name=HMBOX1)

[Back to BioLiP]