Structure of PDB 4j09 Chain A Binding Site BS01

Receptor Information

>4j09 Chain A (length=262) Species: 83333 (Escherichia coli K-12)

MIDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLKSHVVV
NGHTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHR
GTVQGGGLTKVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDF
AIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIE
GLKRRGFSREAITAIRNAYKLIYRSGKTLDEVKPEIAELAETYPEVKAFT
DFFARSTRGLIR

Ligand information

>4j09 Chain B (length=6) Species: 83333 (Escherichia coli K-12)

TNLYML

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4j09 Structural Basis for the Recognition of Peptide RJPXD33 by Acyltransferases in Lipid A Biosynthesis.
• Resolution: 1.9 Å
• Binding residue (original residue number in PDB): Q73 H122 A124 H125 T140 A158 H160 G176 V177 H191
• Binding residue (residue number reindexed from 1): Q73 H122 A124 H125 T140 A158 H160 G176 V177 H191

Enzymatic activity

• Catalytic site (original residue number in PDB): H125 D126 G143
• Catalytic site (residue number reindexed from 1): H125 D126 G143
• Enzyme Commision number: 2.3.1.129: acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase.

Gene Ontology

Molecular Function

• GO:0008780 acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase activity
• GO:0016740 transferase activity
• GO:0016746 acyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
• GO:0042802 identical protein binding

Biological Process

• GO:0008610 lipid biosynthetic process
• GO:0009245 lipid A biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4j09, PDBe:4j09, PDBj:4j09
• PDBsum: 4j09
• PubMed: 24742680
• UniProt: P0A722|LPXA_ECOLI Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (Gene Name=lpxA)