Structure of PDB 4izz Chain A Binding Site BS01

Receptor Information

>4izz Chain A (length=294) Species: 98439 (Fischerella thermalis PCC 7521) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTY
LEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLI
QFPYVWMEKYPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLITSFE
FLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDSPWG
MPFYALTRPFYAPADDQERTYIMVEDTARFFRMMRDWAEKRPNTMRVLEE
LDILPEKMQQAKDELDEIIRAWADKYHQDDGVPVVLQMVFGKKE

Ligand information

>4izz Chain C (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gtgaggggttaaacccctcac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4izz Structures of complexes comprised of Fischerella transcription factor HetR with Anabaena DNA targets.
Resolution	2.502 Å
Binding residue (original residue number in PDB)	H69 E71 R74
Binding residue (residue number reindexed from 1)	H65 E67 R70

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004252	serine-type endopeptidase activity
GO:0008236	serine-type peptidase activity

	Biological Process
GO:0006508	proteolysis
GO:0043158	heterocyst development

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4izz, PDBe:4izz, PDBj:4izz
PDBsum	4izz
PubMed	23610410
UniProt	Q2ACK9

[Back to BioLiP]