Structure of PDB 4iuf Chain A Binding Site BS01

Receptor Information
>4iuf Chain A (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF
TEYETQVKVMSQRHMIDGRWCDCKLPN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4iuf The crystal structure of TDP-43 RRM1-DNA complex reveals the specific recognition for UG- and TG-rich nucleic acids.
Resolution2.752 Å
Binding residue
(original residue number in PDB)		D105 I107 L109 G110 L111 W113 K136 G146 F149 R171 K176 P178 N179
Binding residue
(residue number reindexed from 1)		D3 I5 L7 G8 L9 W11 K34 G44 F47 R69 K74 P76 N77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4iuf, PDBe:4iuf, PDBj:4iuf
PDBsum4iuf
PubMed24464995
UniProtQ13148|TADBP_HUMAN TAR DNA-binding protein 43 (Gene Name=TARDBP)

[Back to BioLiP]