Structure of PDB 4iri Chain A Binding Site BS01

Receptor Information
>4iri Chain A (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKP
NMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4iri Structural and dynamic studies of the transcription factor ERG reveal DNA binding is allosterically autoinhibited.
Resolution2.77 Å
Binding residue
(original residue number in PDB)		Y345 R350 R353 Y356 K363 R368 Y369
Binding residue
(residue number reindexed from 1)		Y54 R59 R62 Y65 K72 R77 Y78
Binding affinityPDBbind-CN: Kd=37nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4iri, PDBe:4iri, PDBj:4iri
PDBsum4iri
PubMed23898196
UniProtP11308|ERG_HUMAN Transcriptional regulator ERG (Gene Name=ERG)

[Back to BioLiP]