Structure of PDB 4iqr Chain A Binding Site BS01

Receptor Information
>4iqr Chain A (length=302) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKD
KRNQCRYCRLKKCFRAGMKKEAVQNEINALLQAEVLSRQITSPVSGINGD
IRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAG
EHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLP
FQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYIND
RQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLL
GG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4iqr Multidomain integration in the structure of the HNF-4 alpha nuclear receptor complex.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		K61 H62 Y63 K72 R76 R80 Q122
Binding residue
(residue number reindexed from 1)		K13 H14 Y15 K24 R28 R32 Q74
Binding affinityPDBbind-CN: Kd=80nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0003707 nuclear steroid receptor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4iqr, PDBe:4iqr, PDBj:4iqr
PDBsum4iqr
PubMed23485969
UniProtP41235|HNF4A_HUMAN Hepatocyte nuclear factor 4-alpha (Gene Name=HNF4A)

[Back to BioLiP]