Structure of PDB 4ioi Chain A Binding Site BS01

Receptor Information
>4ioi Chain A (length=214) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIQMTQSPILLSASVGDRVTITCRASQDVNTAVAWYQQRTNGSPRLLIYS
ASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDIADYYCQQHYTTPPTFGA
GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG
LSSPVTKSFNRGEC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ioi Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		I9 Q38 T40 N41 G42 A84 D85 Y87 K103
Binding residue
(residue number reindexed from 1)		I9 Q38 T40 N41 G42 A84 D85 Y87 K103
External links