Structure of PDB 4in9 Chain A Binding Site BS01

Receptor Information
>4in9 Chain A (length=162) Species: 28112 (Tannerella forsythia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YVLQGSKWNKTTLKYYIYNLTTTERENAIRSAFALWSDKSTLSFIQVYNP
NQADIKIKWEKGNHGDGYPFDGNTGILAHAFYPPPAGGNYAGHLHFDDDE
NWSINGSGIDLITVAAHEIGHLLGIEHSNVSSALMYPYYTGIKRQLDNDD
CLAVWDLYGYPF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4in9 Structure of the catalytic domain of the Tannerella forsythia matrix metallopeptidase karilysin in complex with a tetrapeptidic inhibitor.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		L115 A116 V152 H155 E156 H159 H165 P175 Y176 Y177
Binding residue
(residue number reindexed from 1)		L77 A78 V114 H117 E118 H121 H127 P137 Y138 Y139
Enzymatic activity
Catalytic site (original residue number in PDB) H155 E156 H159 H165
Catalytic site (residue number reindexed from 1) H117 E118 H121 H127
Enzyme Commision number 3.4.24.-
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4in9, PDBe:4in9, PDBj:4in9
PDBsum4in9
PubMed23695557
UniProtD0EM77|KLY_TANFA Karilysin (Gene Name=kly)

[Back to BioLiP]