Structure of PDB 4ilv Chain A Binding Site BS01

Receptor Information

>4ilv Chain A (length=155) Species: 862751 (Streptomyces sp. SirexAA-E)

DPTPDQMEGPYFKPDSPPRTSLVTSSTPGVPLTVSGYVFGRACKPLTGVL
LDFWQADTGGAYDMTGFAFRGHQFTGADGSFTLRTIVPGLYPGRTRHIHV
KAQAPGRPVLTTQLYFPGEPRNTTDALFDPALLMNVRSAGPGREGTFDFV
LDVAQ

Ligand information

• Ligand ID: FE
• InChI: InChI=1S/Fe/q+3
• InChIKey: VTLYFUHAOXGGBS-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [Fe+3]
• Formula: Fe
• Name: FE (III) ION
• DrugBank: DB13949
• PDB chain: 4ilv Chain A Residue 301

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4ilv Fusion of Dioxygenase and Lignin-binding Domains in a Novel Secreted Enzyme from Cellulolytic Streptomyces sp. SirexAA-E.
• Resolution: 2.06 Å
• Binding residue (original residue number in PDB): Y138 Y167 H173 H175
• Binding residue (residue number reindexed from 1): Y62 Y91 H97 H99
• Annotation score: 4

Enzymatic activity

• Catalytic site (original residue number in PDB): Y138 R160 G169 R172 I174
• Catalytic site (residue number reindexed from 1): Y62 R84 G93 R96 I98

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds
• GO:0005506 iron ion binding
• GO:0008199 ferric iron binding
• GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
• GO:0030246 carbohydrate binding

Biological Process

• GO:0005975 carbohydrate metabolic process

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:4ilv, PDBe:4ilv, PDBj:4ilv
• PDBsum: 4ilv
• PubMed: 23653358
• UniProt: G2NEL6