Structure of PDB 4ijs Chain A Binding Site BS01

Receptor Information
>4ijs Chain A (length=232) Species: 35304 (Bunyamwera virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IELEFHDVAANTSSTFDPEVAYANFKRVHTTGLSYDHIRIFYIKGREIKT
SLAKRSEWEVTLNLGGWKITVYNTNFPGNRNSPVPDDGLTLHRLSGFLAR
YLLEKMLKVSEPEKLIIKSKIINPLAEKNGITWNDGEEVYLSFFPGSEMF
LGTFRFYPLAIGIYKVQRKEMEPKYLEKTMRQRYMGLEAATWTVSKLTEV
QSALTVVSSLGWKKTNVSAAARDFLAKFGINM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ijs Bunyamwera virus possesses a distinct nucleocapsid protein to facilitate genome encapsidation
Resolution3.2 Å
Binding residue
(original residue number in PDB)		S15 F17 D18 P19 R47 T75 T91 R94 P125 L126 E128 Y176 K179 R182 R184
Binding residue
(residue number reindexed from 1)		S14 F16 D17 P18 R46 T74 T90 R93 P124 L125 E127 Y175 K178 R181 R183
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0039657 symbiont-mediated suppression of host gene expression
Cellular Component
GO:0019013 viral nucleocapsid
GO:0019029 helical viral capsid
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ijs, PDBe:4ijs, PDBj:4ijs
PDBsum4ijs
PubMed23569257
UniProtP16495|NCAP_BUNYW Nucleoprotein (Gene Name=N)

[Back to BioLiP]