Structure of PDB 4ij8 Chain A Binding Site BS01

Receptor Information

>4ij8 Chain A (length=161) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDF
VVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETN
RLGRLINHSKSGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSK
ASIEAHPWLKH

Ligand information

>4ij8 Chain I (length=10) Species: 32644 (unidentified) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAAAAAAAAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4ij8 Crystal structure of the complex of SETD8 with SAM
Resolution	2.0 Å
Binding residue (original residue number in PDB)	R279 G280 Q347 S364
Binding residue (residue number reindexed from 1)	R47 G48 Q115 S132

Enzymatic activity

Enzyme Commision number

2.1.1.-
2.1.1.361: [histone H4]-lysine(20) N-methyltransferase.

Gene Ontology

	Molecular Function
GO:0042799	histone H4K20 methyltransferase activity

View graph for
Molecular Function

External links

PDB	RCSB:4ij8, PDBe:4ij8, PDBj:4ij8
PDBsum	4ij8
PubMed
UniProt	Q9NQR1\|KMT5A_HUMAN N-lysine methyltransferase KMT5A (Gene Name=KMT5A)

[Back to BioLiP]