Structure of PDB 4ii9 Chain A Binding Site BS01

Receptor Information
>4ii9 Chain A (length=337) Species: 1629 (Weissella viridescens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVLNLNDPQAVERYEEFMRQSPYGQVTQDLGWAKVKNNWEPVDVYLEDDQ
GAIIAAMSMLLGDTPTDKKFAYASKGPVMDVTDVDLLDRLVDEAVKALDG
RAYVLRFDPEVAYSDEFNTTLQDHGYVTRNRNVADAGMHATIQPRLNMVL
DLTKFPDAKTTLDLYPSKTKSKIKRPFRDGVEVHSGNSATELDEFFKTYT
TMAERHGITHRPIEYFQRMQAAFDADTMRIFVAEREGKLLSTGIALKYGR
KIWYMYAGSMDGNTYYAPYAVQSEMIQWALDTNTDLYDLGGIESESTDDS
LYVFKHVFVKDAPREYIGEIDKVLDPEVYAELVKDGH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ii9 The Structure of FemXWv in Complex with a Peptidyl-RNA Conjugate: Mechanism of Aminoacyl Transfer from Ala-tRNA(Ala) to Peptidoglycan Precursors
Resolution1.66 Å
Binding residue
(original residue number in PDB)
W32 K36 H139 Q143 I208 T209 R211 Y215 Y256
Binding residue
(residue number reindexed from 1)
W32 K36 H139 Q143 I208 T209 R211 Y215 Y256
Enzymatic activity
Catalytic site (original residue number in PDB) K36 D108 R211 F304 K305 E319
Catalytic site (residue number reindexed from 1) K36 D108 R211 F304 K305 E319
Enzyme Commision number 2.3.2.10: UDP-N-acetylmuramoylpentapeptide-lysine N(6)-alanyltransferase.
Gene Ontology
Molecular Function
GO:0016746 acyltransferase activity
GO:0016755 aminoacyltransferase activity
GO:0047206 UDP-N-acetylmuramoylpentapeptide-lysine N6-alanyltransferase activity
Biological Process
GO:0008360 regulation of cell shape
GO:0009252 peptidoglycan biosynthetic process
GO:0044038 cell wall macromolecule biosynthetic process
GO:0071555 cell wall organization

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4ii9, PDBe:4ii9, PDBj:4ii9
PDBsum4ii9
PubMed23744707
UniProtQ9EY50|FEMX_WEIVI UDP-N-acetylmuramoylpentapeptide-lysine N(6)-alanyltransferase (Gene Name=femX)

[Back to BioLiP]