Structure of PDB 4iga Chain A Binding Site BS01

Receptor Information
>4iga Chain A (length=116) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVT
MDITMPEMNGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFI
VKPFQPSRVVEALNKV
Ligand information
>4iga Chain B (length=16) Species: 243274 (Thermotoga maritima MSB8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DVLSQEEINQLIEALM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4iga The crystal structure of an activated Thermotoga maritima CheY with N-terminal region of FliM.
Resolution1.73 Å
Binding residue
(original residue number in PDB)		G85 Q86 Q87 I94 F101 V103 R110
Binding residue
(residue number reindexed from 1)		G83 Q84 Q85 I92 F99 V101 R108
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006935 chemotaxis
GO:0097588 archaeal or bacterial-type flagellum-dependent cell motility
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4iga, PDBe:4iga, PDBj:4iga
PDBsum4iga
PubMed23237794
UniProtQ56312|CHEY_THEMA Chemotaxis protein CheY (Gene Name=cheY)

[Back to BioLiP]