Structure of PDB 4ifi Chain A Binding Site BS01

Receptor Information
>4ifi Chain A (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCE
RTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQG
PKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSF
TLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQ
ELDTYLIPQIP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ifi Structural Basis for the BRCA1 BRCT Interaction with the Proteins ATRIP and BAAT1.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		S1655 R1699 K1702 N1774 M1775
Binding residue
(residue number reindexed from 1)		S7 R51 K54 N126 M127
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004842 ubiquitin-protein transferase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006281 DNA repair
GO:0006974 DNA damage response
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ifi, PDBe:4ifi, PDBj:4ifi
PDBsum4ifi
PubMed24073851
UniProtP38398|BRCA1_HUMAN Breast cancer type 1 susceptibility protein (Gene Name=BRCA1)

[Back to BioLiP]