Structure of PDB 4ifd Chain A Binding Site BS01

Receptor Information
>4ifd Chain A (length=300) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKDIEISASESKFILEALRQNYRLDGRSFDQFRDVEITFGKEFGDVSVKM
GNTKVHCRISCQIAQPYEDRPFEGLFVISTEISPMAGSQFENGNITGEDE
VLCSRIIEKSVRRSGALDVEGLCIVAGSKCWAVRADVHFLDCDGGFIDAS
CIAVMAGLMHFKKPDITVHGEQIIVHPVNEREPVPLGILHIPICVTFSFF
NPQDTEENIKGETNSEISIIDATLKEELLRDGVLTVTLNKNREVVQVSKA
GGLPMDALTLMKCCHEAYSIIEKITDQILQLLKEDSEKRNKYAAMLTSEN
Ligand information
>4ifd Chain R (length=30) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccccgagaggggguuuuuuuuuuuuuuuuu
<<<<....>>>>..................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ifd Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
Resolution2.805 Å
Binding residue
(original residue number in PDB)		Y68 D70
Binding residue
(residue number reindexed from 1)		Y67 D69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0035925 mRNA 3'-UTR AU-rich region binding
Biological Process
GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0006401 RNA catabolic process
GO:0034473 U1 snRNA 3'-end processing
GO:0034475 U4 snRNA 3'-end processing
GO:0034476 U5 snRNA 3'-end processing
GO:0071028 nuclear mRNA surveillance
GO:0071035 nuclear polyadenylation-dependent rRNA catabolic process
GO:0071038 TRAMP-dependent tRNA surveillance pathway
Cellular Component
GO:0000176 nuclear exosome (RNase complex)
GO:0000177 cytoplasmic exosome (RNase complex)
GO:0000178 exosome (RNase complex)
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ifd, PDBe:4ifd, PDBj:4ifd
PDBsum4ifd
PubMed23376952
UniProtQ05636|RRP45_YEAST Exosome complex component RRP45 (Gene Name=RRP45)

[Back to BioLiP]