Structure of PDB 4ia3 Chain A Binding Site BS01

Receptor Information

>4ia3 Chain A (length=239) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVRRLSMLPHLADLVS
YSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMS
WSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMA
ICLLSPDRPGVQDHVRIEALQDRLCDVLQAYIRIQHPGGRLLYAKMIQKL
ADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEV

Ligand information

>4ia3 Chain B (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KHKILHRLLQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4ia3 Diastereotopic and deuterium effects in gemini.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	I270 K274 R280 I288 K292 E446 E451
Binding residue (residue number reindexed from 1)	I57 K61 R67 I75 K79 E233 E238

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4ia3, PDBe:4ia3, PDBj:4ia3
PDBsum	4ia3
PubMed	23566225
UniProt	Q9PTN2\|VDRA_DANRE Vitamin D3 receptor A (Gene Name=vdra)

[Back to BioLiP]