Structure of PDB 4i7z Chain A Binding Site BS01

Receptor Information

>4i7z Chain A (length=213) Species: 83541 (Mastigocladus laminosus)

NVYDWFQERLEIQALADDVTSKYVPPHVNIFYCLGGITLTCFLIQFATGF
AMTFYYKPTVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVF
RVYLTGGFKKPRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKIVS
GVPEAIPVVGVLISDLLRGGSSVGQATLTRYYSAHTFVLPWLIAVFMLLH
FLMIRKQGISGPL

Ligand information

>4i7z Chain H (length=28) Species: 83541 (Mastigocladus laminosus)

EIDVLGWVALLVVFTWSIAMVVWGRNGL

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4i7z Lipid-induced conformational changes within the cytochrome b6f complex of oxygenic photosynthesis.
• Resolution: 2.803 Å
• Binding residue (original residue number in PDB): N31 I32
• Binding residue (residue number reindexed from 1): N29 I30

Enzymatic activity

• Catalytic site (original residue number in PDB): R207 I211
• Catalytic site (residue number reindexed from 1): R205 I209

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:4i7z, PDBe:4i7z, PDBj:4i7z
• PDBsum: 4i7z
• PubMed: 23514009
• UniProt: P83791|CYB6_MASLA Cytochrome b6 (Gene Name=petB)