Structure of PDB 4i67 Chain A Binding Site BS01

Receptor Information
>4i67 Chain A (length=76) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AERSLLTGEEGWRTYKATGPRLSLPRLVALLKGQGLEVGKVAEAEGGFYV
DLRPEARPEVAGLRLEPARRVEGLLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4i67 Recognition of two distinct elements in the RNA substrate by the RNA-binding domain of the T. thermophilus DEAD box helicase Hera.
Resolution2.33 Å
Binding residue
(original residue number in PDB)		E432 L447 R449 A452 K455 V461 G462 K463 V464
Binding residue
(residue number reindexed from 1)		E9 L24 R26 A29 K32 V38 G39 K40 V41
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
External links