Structure of PDB 4hzl Chain A Binding Site BS01

Receptor Information
>4hzl Chain A (length=217) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVMLVESGGDLVKPGGSLKLPCAASGFTVSTYAMSWIRQTPEKRLEWVAT
ISSGGSYTYYPDNVKGRFTISRDIAKNTLYLQMSSLRSEDTAMYYCARHP
PTVVAGDAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYF
PEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCN
VAHPASSTKVDKKIVPR
Ligand information
>4hzl Chain F (length=13) Species: 1006431 (Recombinant Hepatitis C virus H77(5'UTR-NS2)/JFH1_V787A,Q1247L) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NESLNTGWLAGLF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hzl Structural evidence for a bifurcated mode of action in the antibody-mediated neutralization of hepatitis C virus.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		A33 S52 S53 G54 S56 Y57 Y59 P101 T102 G106 D107
Binding residue
(residue number reindexed from 1)		A33 S52 S53 G54 S56 Y57 Y59 P101 T102 G106 D107
External links