Structure of PDB 4hy9 Chain A Binding Site BS01

Receptor Information
>4hy9 Chain A (length=213) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTI
HVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSA
KDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQ
GDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKM
QELAQVSQKLMEI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hy9 Structural Studies on the Forward and Reverse Binding Modes of Peptides to the Chaperone DnaK.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		T403 M404 Q424 F426 S427 T428 E430 Q433 V436 R467 I472 D540
Binding residue
(residue number reindexed from 1)		T15 M16 Q36 F38 S39 T40 E42 Q45 V48 R79 I84 D152
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0140662 ATP-dependent protein folding chaperone

View graph for
Molecular Function
External links
PDB RCSB:4hy9, PDBe:4hy9, PDBj:4hy9
PDBsum4hy9
PubMed23562829
UniProtP0A6Y8|DNAK_ECOLI Chaperone protein DnaK (Gene Name=dnaK)

[Back to BioLiP]