Structure of PDB 4hxj Chain A Binding Site BS01

Receptor Information
>4hxj Chain A (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYI
PSNYVAPSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hxj Structural framework of c-Src activation by integrin beta 3
Resolution2.0 Å
Binding residue
(original residue number in PDB)		E115 D117 W118
Binding residue
(residue number reindexed from 1)		E33 D35 W36
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Gene Ontology
Biological Process
GO:0006897 endocytosis
GO:0051666 actin cortical patch localization

View graph for
Biological Process
External links
PDB RCSB:4hxj, PDBe:4hxj, PDBj:4hxj
PDBsum4hxj
PubMed23169783
UniProtP12931|SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]