Structure of PDB 4hvw Chain A Binding Site BS01

Receptor Information
>4hvw Chain A (length=61) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMTFVALYDYESRTEEDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTG
YIPSNYVAPSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hvw Atomic resolution structures of the c-Src SH3 domain in complex with two high-affinity peptides from classes I and II.
Resolution0.98 Å
Binding residue
(original residue number in PDB)		Y90 D99 E115 G116 D117 W118 Y131 P133 N135 Y136
Binding residue
(residue number reindexed from 1)		Y10 D19 E35 G36 D37 W38 Y51 P53 N55 Y56
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:4hvw, PDBe:4hvw, PDBj:4hvw
PDBsum4hvw
PubMed23633584
UniProtP00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]