Structure of PDB 4hvv Chain A Binding Site BS01

Receptor Information
>4hvv Chain A (length=56) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFVALYDYESRTEEDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPS
NYVAPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hvv Atomic resolution structures of the c-Src SH3 domain in complex with two high-affinity peptides from classes I and II.
Resolution1.1 Å
Binding residue
(original residue number in PDB)
Y90 Y92 R95 T96 D99 E115 G116 D117 W118 P133 N135 Y136
Binding residue
(residue number reindexed from 1)
Y6 Y8 R11 T12 D15 E31 G32 D33 W34 P49 N51 Y52
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:4hvv, PDBe:4hvv, PDBj:4hvv
PDBsum4hvv
PubMed23633584
UniProtP00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]