Structure of PDB 4ht9 Chain A Binding Site BS01

Receptor Information

>4ht9 Chain A (length=60) Species: 469008 (Escherichia coli BL21(DE3))

SLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVY
KHAISTVVPS

Ligand information

>4ht9 Chain D (length=7)

aaaaaaa

.......

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4ht9 Hfq-bridged ternary complex is important for translation activation of rpoS by DsrA.
• Resolution: 1.8 Å
• Binding residue (original residue number in PDB): Y25 G29 I30 K31 L32 Q33 N48 Q52 T61
• Binding residue (residue number reindexed from 1): Y20 G24 I25 K26 L27 Q28 N43 Q47 T56
• Binding affinity: PDBbind-CN: Kd=392nM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Nov 27 12:10:57 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4ht9', asym_id = 'A', bs = 'BS01', title = 'Hfq-bridged ternary complex is important for translation activation of rpoS by DsrA.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4ht9', asym_id='A', bs='BS01', title='Hfq-bridged ternary complex is important for translation activation of rpoS by DsrA.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003723,0006355', uniprot = '', pdbid = '4ht9', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0006355', uniprot='', pdbid='4ht9', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>