Structure of PDB 4ht4 Chain A Binding Site BS01

Receptor Information
>4ht4 Chain A (length=194) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMYHFQNKFVSKANGQSATAKSAFNSASRIKDFKENEFKDYSNKQCDYSE
ILLPNNADDKFKDREYLWNKVHDVENRKNSQVAREIIIGLPNEFDPNSNI
ELAKEFAESLSNEGMIVDLNIHKINEENPHAHLLCTLRGLDKNNEFEPKR
KGNDYIRDWNTKEKHNEWRKRWENVQNKHLEKNGFSVRVSADSY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ht4 Molecular basis of antibiotic multiresistance transfer in Staphylococcus aureus.
Resolution2.907 Å
Binding residue
(original residue number in PDB)		A2 M3 H5 N8 F10 S12 R78 K79 N80 S81 Q82 R85 L91 N93 E128 N129 P130 R139 K150 R151 G153 N154 Y156 T162 K163 H166 N167 R170
Binding residue
(residue number reindexed from 1)		A1 M2 H4 N7 F9 S11 R77 K78 N79 S80 Q81 R84 L90 N92 E127 N128 P129 R138 K149 R150 G152 N153 Y155 T161 K162 H165 N166 R169
Binding affinityPDBbind-CN: Kd=8nM
Enzymatic activity
Enzyme Commision number ?
External links