Structure of PDB 4hsb Chain A Binding Site BS01

Receptor Information
>4hsb Chain A (length=205) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDYKRAEKHLSSIDNKWSSLVKKVGPCTLTPHPEHAPYEGIIRAITSQKL
SDAATNSIINKFCTQCSDNDEFPTPKQIMETDVETLHECGFSKLKSQEIH
IVAEAALNKQIPSKSEIEKMSEEELMESLSKIKGVKRWTIEMYSIFTLGR
LDIMPADDSTLKNEAKEFFGLSSKPQTEEVEKLTKPCKPYRTIAAWYLWQ
IPKLH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hsb Non-productive DNA damage binding by DNA glycosylase-like protein Mag2 from Schizosaccharomyces pombe.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Q52 L98 E102 K137 G138 K140 W142 T143 S163
Binding residue
(residue number reindexed from 1)		Q48 L94 E98 K133 G134 K136 W138 T139 S159
Enzymatic activity
Enzyme Commision number 3.2.2.21: DNA-3-methyladenine glycosylase II.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0003905 alkylbase DNA N-glycosylase activity
GO:0032131 alkylated DNA binding
GO:0140431 DNA-(abasic site) binding
Biological Process
GO:0000725 recombinational repair
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006285 base-excision repair, AP site formation
GO:0006289 nucleotide-excision repair
GO:0006307 DNA alkylation repair
Cellular Component
GO:0005634 nucleus
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4hsb, PDBe:4hsb, PDBj:4hsb
PDBsum4hsb
PubMed23273506
UniProtO94468|MAG2_SCHPO Alkylbase DNA glycosidase-like protein mag2 (Gene Name=mag2)

[Back to BioLiP]