Structure of PDB 4hqu Chain A Binding Site BS01

Receptor Information

>4hqu Chain A (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNR
NVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCET

Ligand information

>4hqu Chain C (length=24) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuaccguuacacgcguuuauagcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4hqu Unique motifs and hydrophobic interactions shape the binding of modified DNA ligands to protein targets.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	E24 R27 N36 L38 V39 W40 P42 R73 K74 I75 I77 P82 I83 F84 K85 K86
Binding residue (residue number reindexed from 1)	E18 R21 N30 L32 V33 W34 P36 R67 K68 I69 I71 P76 I77 F78 K79 K80
Binding affinity	PDBbind-CN: Kd=0.02nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0008083	growth factor activity

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:4hqu, PDBe:4hqu, PDBj:4hqu
PDBsum	4hqu
PubMed	23139410
UniProt	P01127\|PDGFB_HUMAN Platelet-derived growth factor subunit B (Gene Name=PDGFB)

[Back to BioLiP]