Structure of PDB 4hqb Chain A Binding Site BS01

Receptor Information
>4hqb Chain A (length=143) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLQIEFITDLGARVTVNVEHESRLLDVQRHYGRLGWTSGEIPSGGYQFPI
ENEADFDWSLIGARKWKSPEGEELVIHRGHAYRRRELEAVDSRKLKLPAA
IKYSRGAKVSDPQHVREKADGDIEYVSLAIFRGGKRQERYAVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hqb Crystal structure of the DdrB/ssDNA complex from Deinococcus radiodurans reveals a DNA binding surface involving higher-order oligomeric states.
Resolution2.301 Å
Binding residue
(original residue number in PDB)
R64 W66 L74 G79 A81 R83
Binding residue
(residue number reindexed from 1)
R64 W66 L74 G79 A81 R83
Binding affinityPDBbind-CN: Kd=3.6uM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4hqb, PDBe:4hqb, PDBj:4hqb
PDBsum4hqb
PubMed23975200
UniProtQ9RY80|DDRB_DEIRA Single-stranded DNA-binding protein DdrB (Gene Name=ddrB)

[Back to BioLiP]